Tested Applications
| Positive WB detected in | A375 cells, HEK-293T cells, NIH/3T3 cells, HCT 116 cells, HeLa cells, K-562 cells |
| Positive IHC detected in | human colon cancer tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27566-1-AP targets TAB1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25576 Product name: Recombinant human MAP3K7IP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 400-504 aa of BC050554 Sequence: TSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP Predict reactive species |
| Full Name | mitogen-activated protein kinase kinase kinase 7 interacting protein 1 |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC050554 |
| Gene Symbol | TAB1 |
| Gene ID (NCBI) | 10454 |
| RRID | AB_2880910 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15750 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (TAB1) is also named TAK1-binding protein 1 and MAP3K7IP1. TAB1 is constitutively associated with the composition N-terminal kinase domain of TAK1 and can be activated by pro-inflammatory cytokines (TNFα and IL-1β) and toll-like receptor ligands (PMID: 38072991). TAB1 is a scaffolding protein required for TGF-β activated kinase-1 (TAK1) mediated signalling. TAB1 is a specific protein that interacts with transforming growth factor β-activated kinase 1 (TAK1) (PMID: 32676538). TAB1/TAK1 can activate nuclear factor κB (NF-κB) in high glucose (HG)-induced BMMs, regulating macrophage activation (PMID: 32296020, PMID: 23851980).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TAB1 antibody 27566-1-AP | Download protocol |
| IHC protocol for TAB1 antibody 27566-1-AP | Download protocol |
| WB protocol for TAB1 antibody 27566-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TAB1 Polyclonal antibody (Cat# 27566-1-AP) has 6 citations appearing in Blood, Theranostics, Acta Pharm Sin B, Int J Mol Sci, and Int Dent J. Research fields include sepsis and microvascular thrombosis, viral infection and p38 MAPK signaling, testicular injury in type 2 diabetes, NF-κB signaling in dental pulp cells, hypoxia-related inflammation, and oral squamous cell carcinoma involving mTORC1/NF-κB activation.
| Species | Application | Title |
|---|---|---|
Acta Pharm Sin B Melatonin receptor 1a alleviates sleep fragmentation-aggravated testicular injury in T2DM by suppression of TAB1/TAK1 complex through FGFR1 | ||
Int J Mol Sci MicroRNA-27a-5p Downregulates Expression of Proinflammatory Cytokines in Lipopolysaccharide-Stimulated Human Dental Pulp Cells via the NF-κB Signaling Pathway
| ||
Int J Mol Sci MicroRNA-210 Suppresses NF-κB Signaling in Lipopolysaccharide-Stimulated Dental Pulp Cells Under Hypoxic Conditions. | ||
Int Dent J TTK Defines a High-Risk Oral Squamous Cell Carcinoma Subtype Through Dual mTORC1/NF-κB Activation. |
Reviews
What customers say
The single review for this product reports successful use in both Western Blot and Immunohistochemistry on liver tissue, with a 1:1000 dilution. The reviewer rated it 4 out of 5 stars, noting that it "works well" for both applications. Overall, the feedback is positive, confirming reliable performance across two common techniques.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (11-26-2025) | works well for wb and IHC
|
