MAP4K3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MAP4K3 Polyclonal antibody (14702-1-AP)

• Featured Product
• KD/KO Validated

MAP4K3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14702-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

GLK, MAP4K3, MAPKKKK3, MEK kinase kinase 3, MEKKK 3, RAB8IPL1

• 

  WB analysis of human skeletal muscle using 14702-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14702-1-AP (MAP4K3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 14702-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14702-1-AP (MAP4K3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14702-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14702-1-AP (MAP4K3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 14702-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 14702-1-AP (MAP4K3 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 14702-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 14702-1-AP (MAP4K3 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 14702-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 14702-1-AP (MAP4K3 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 14702-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 14702-1-AP (MAP4K3 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MAP4K3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human skeletal muscle tissue, HeLa cells, human brain tissue
• Positive IHC detected in: human skeletal muscle tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14702-1-AP targets MAP4K3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6372

  Product name: Recombinant human MAP4K3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 537-873 aa of BC071579

  Sequence: KIHCASSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSISGKASQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKFSVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIDFPIPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESDTPQTNVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY

• Full Name: mitogen-activated protein kinase kinase kinase kinase 3
• Calculated Molecular Weight: 101 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC071579
• Gene Symbol: MAP4K3
• Gene ID (NCBI): 8491
• RRID: AB_10858917
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IVH8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAP4K3(Mitogen-activated protein kinase kinase kinase kinase 3) has kinase activity and that it activates JNK but not MAPK1, MAPK3 or MAPK14 through the activation of MAP3K1 and MAP2K4. Endogenous MAP4K3 kinase activity could be stimulated by exposure to ultraviolet radiation or to tumor necrosis factor.

Publications

What published studies show

The MAP4K3 Polyclonal antibody (Cat# 14702-1-AP) has 1 citation. It was used in a study published in Bioengineered (2022), investigating how MAP4K3 promotes diabetic nephropathy progression via apoptosis induction, inhibited by Astragaloside IV through H3K4 monomethylation. The research field encompasses diabetic nephropathy, apoptosis, and MAPK signaling pathway regulation, with the antibody applied in Western blot (WB) for mouse and rat samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,rat	WB	Bioengineered; Mitogen-activating protein kinase kinase kinase kinase-3, inhibited by Astragaloside IV through H3 lysine 4 monomethylation, promotes the progression of diabetic nephropathy by inducing apoptosis.; Authors - Yuyan Fan ; KD Validated