JNK Polyclonal antibody

JNK Polyclonal Antibody for WB, IHC, ELISA
Cat No. 28007-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, canine and More (3)

Applications

WB, IHC, ELISA

c Jun N terminal kinase 3, FLJ12099, FLJ33785, JNK, JNK1, JNK1/2/3, JNK2, JNK3, JNK3A, MAP kinase 10, MAP kinase p49 3F12, MAPK 10, MAPK10, MAPK8, MAPK8/9/10, MAPK9, p493F12, p54bSAPK, PRKM10

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNeuro-2a cells, MDCK cells, mouse brain tissue, mouse cerebellum tissue
Positive IHC detected inmouse brain tissue, mouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 5 publications below

Product Information

28007-1-AP targets JNK in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, canine samples.

Tested Reactivity Human, Mouse, canine
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27823

Product name: Recombinant human MAPK10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 271-408 aa of BC065516

Sequence: QWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNG

Predict reactive species
Full Name mitogen-activated protein kinase 10
Calculated Molecular Weight 464 aa, 53 kDa
Observed Molecular Weight 45-48 kDa, 54-57 kDa
GenBank Accession NumberBC065516
Gene Symbol JNK3
Gene ID (NCBI) 5602
RRIDAB_2881035
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP53779
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

JNK, also named MAPK10 (mitogen-activated protein kinase 10), belongs to MAP kinase family. MAP kinases act as integration points for multiple biochemical signals, and thus are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcription regulation and development. This kinase is mainly expressed in a subset of neurons in the nervous system, and is activated by threonine and tyrosine phosphorylation. JNK has 3 isoforms of 48-53 kDa.

Protocols

Product Specific Protocols
WB protocol for JNK antibody 28007-1-APDownload protocol
IHC protocol for JNK antibody 28007-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

Sci Total Environ

Exploring potential targets and mechanisms of renal tissue damage caused by N-(1,3-dimethylbutyl)-N'-phenyl-p-phenylenediamine quinone (6-PPDQ) through network toxicology and animal experiments: A case of chronic kidney disease

Authors - Jun Pei
ratWB

Front Immunol

Identification of ALDH2 as a novel target for the treatment of acute kidney injury in kidney transplantation based on WGCNA and machine learning algorithms and exploration of its potential mechanism of action using animal experiments

Authors - Jinpu Peng
mouseWB

Int J Biol Macromol

VSIG4 inhibits RANKL-induced osteoclastogenesis by enhancing Nrf2-dependent antioxidant response against reactive oxygen species production

Authors - Jiansen Miao
humanWB

Int Immunopharmacol

Molecular mechanisms and potential targets of lycopene for alleviating renal ischemia-reperfusion injury revealed by network pharmacology and animal experiments

Authors - Xingyu Pan
humanWB

Nat Commun

SARS-CoV-2 N protein-induced Dicer, XPO5, SRSF3, and hnRNPA3 downregulation causes pneumonia

Authors - Yu-Wei Luo
Loading...
||
New chat Able
正在加载,请稍候...