MAPK4 Polyclonal antibody

• 

  WB analysis of mouse brain using 26102-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26102-1-AP (MAPK4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 26102-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26102-1-AP (MAPK4 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 26102-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26102-1-AP (MAPK4 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MAPK4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26102-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

ERK 4, ERK3, Erk4, MAP kinase 4, MAP kinase isoform p63, MAPK 4, MAPK4, p63 MAPK, p63MAPK, PRKM4

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 3 publications below

Product Information

26102-1-AP targets MAPK4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22899

  Product name: Recombinant human MAPK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 307-587 aa of BC050299

  Sequence: LQHPYMSPYSCPEDEPTSQHPFRIEDEIDDIVLMAANQSQLSNWDTCSSRYPVSLSSDLEWRPDRCQDASEVQRDPRAGSAPLAEDVQVDPRKDSHSSSERFLEQSHSSMERAFEADYGRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPTATGLADTGAREDEPASLFLEIAQWVKSTQGGPEHASPPADDPERRLSASPPGRPAPVDGGASPQFDLDVFISRALKLCTKPEDLPDNKLGDLNGACIPEHPGDLVQTEAFSKERW

• Full Name: mitogen-activated protein kinase 4
• Calculated Molecular Weight: 587 aa, 66 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC050299
• Gene Symbol: MAPK4
• Gene ID (NCBI): 5596
• RRID: AB_2880378
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31152
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Cell Biosci; Identification of atypical mitogen-activated protein kinase MAPK4 as a novel regulator in acute lung injury.; Authors - Ling Mao
pig	WB	J Cell Physiol; MiR-127 attenuates adipogenesis by targeting MAPK4 and HOXC6 in porcine adipocytes.; Authors - Yun Gao
mouse	WB	Front Pharmacol; An Integrated Proteomics and Bioinformatics Approach Reveals the Anti-inflammatory Mechanism of Carnosic Acid.; Authors - Li-Chao Wang
human,mouse	WB,IF	Cancer Innov; MAPK4 facilitates angiogenesis by inhibiting the ERK pathway in non-small cell lung cancer; Authors - Jing Chen
human	WB,IF	Mol Neurobiol; Microcystin-LR Exposure Damages Neurons by Inducing α-Syn Aggregation via MAPK4/GATA2/SNCA and PP2A/GRKs Pathways; Authors - Minghao Yan