MAPKSP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MAPKSP1 Polyclonal antibody (11937-1-AP)

MAPKSP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11937-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

LAMTOR3, MAP2K1IP1, MAPBP, MAPK scaffold protein 1, MAPKSP1, MEK binding partner 1, MP1

• 

  WB analysis of human liver using 11937-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11937-1-AP (MAPKSP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 11937-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11937-1-AP (MAPKSP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 11937-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 11937-1-AP (MAPKSP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 11937-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11937-1-AP (MAPKSP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11937-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11937-1-AP (MAPKSP1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 11937-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 11937-1-AP (MAPKSP1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 11937-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 11937-1-AP (MAPKSP1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11937-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11937-1-AP (MAPKSP1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11937-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11937-1-AP (MAPKSP1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 11937-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 11937-1-AP (MAPKSP1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 11937-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 11937-1-AP (MAPKSP1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human liver tissue, L02 cells, mouse brain tissue, mouse liver tissue
• Positive IHC detected in: human prostate cancer tissue, human heart tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11937-1-AP targets MAPKSP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2534

  Product name: Recombinant human MAPKSP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-124 aa of BC026245

  Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

• Full Name: MAPK scaffold protein 1
• Calculated Molecular Weight: 124 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC026245
• Gene Symbol: MAPKSP1
• Gene ID (NCBI): 8649
• RRID: AB_2141610
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHA4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAPKSP1, also named as mitogen activated protein kinase kinase 1 interacting protein 1, Map2k1ip1, MEK partner 1, Lamtor3 and MP1. It was first identified as a scaffold protein enhancing the efficiency of the MAPK pathway by facilitating the interaction between MEK1 and ERK1 upon serum stimulation (PMID: 9733512). Later, it has been demonstrated that MAPKSP1 enhances activation of both ERK1 and ERK2 as a response to EGF (PMID: 12479806) and fibronectin (PMID: 15923628). MAPKSP1 is involved in regulating endosomal signaling (PMID: 17178906), and a role in cancer, via MEK and ERK hyperactivation, has been demostrated in pancreatic tumorigenesis (PMID: 24209743). MAPKSP1 has two isoforms with the molecular weight of 13-14 kDa.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Pharmacol; Brucea javanica Oil Emulsion Promotes Autophagy in Ovarian Cancer Cells Through the miR-8485/LAMTOR3/mTOR/ATG13 Signaling Axis; Authors - Yihan Wang
human	WB	EMBO J; Micropeptide hSPAR regulates glutamine levels and suppresses mammary tumor growth via a TRIM21-P27KIP1-mTOR axis; Authors - Yan Huang