Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | rat brain tissue |
| Positive IHC detected in | human prostate cancer tissue, human brain tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15492-1-AP targets MARK2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7884 Product name: Recombinant human MARK2 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-363 aa of BC008771 Sequence: LNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSELEGDTI Predict reactive species |
| Full Name | MAP/microtubule affinity-regulating kinase 2 |
| Calculated Molecular Weight | 88 kDa |
| Observed Molecular Weight | 77-90 kDa |
| GenBank Accession Number | BC008771 |
| Gene Symbol | MARK2 |
| Gene ID (NCBI) | 2011 |
| RRID | AB_2140752 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7KZI7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MARK2 is also named as EMK1(ELKL motif kinase 1), Par1b and belongs to the CAMK Ser/Thr protein kinase family. Par1b/MARK2 plays a critical role in neuronal polarity in the process of axon specification from multiple candidate neurites using primary cultures of mammalian hippocampal neurons(PMID:20194617). It has 16 isoforms produced by alternative promoter usage and alternative splicing with the molecular mass of 77-90kDa and can exsit as a dimer(PMID:16803889).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MARK2 antibody 15492-1-AP | Download protocol |
| IP protocol for MARK2 antibody 15492-1-AP | Download protocol |
| WB protocol for MARK2 antibody 15492-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MARK2 Polyclonal antibody (Cat# 15492-1-AP) has 19 citations across journals including Nature Communications, Molecular Cell, EMBO Journal, Journal of Neuroscience, FASEB Journal, Endocrinology, Free Radical Biology and Medicine, and others. Research fields span tumor growth and metastasis, neuroinflammation, axon development, Lewy body/synucleinopathies, calcium signaling and stress granules, osteogenesis, epilepsy, blood-testis barrier dynamics, spermatogenesis, male contraception, cell adhesion, and prostate cancer progression.
| Species | Application | Title |
|---|---|---|
Nat Commun TNK1 is a ubiquitin-binding and 14-3-3-regulated kinase that can be targeted to block tumor growth.
| ||
Mol Cell An AMPK-Independent Signaling Pathway Downstream of the LKB1 Tumor Suppressor Controls Snail1 and Metastatic Potential. | ||
J Neuroinflammation Loss of Par1b/MARK2 primes microglia during brain development and enhances their sensitivity to injury.
| ||
Free Radic Biol Med Sophoridine alleviates sepsis-associated encephalopathy by inhibiting MARK4 and NLRP3 signaling. | ||
ACS Appl Mater Interfaces Lithium Promotes Osteogenesis via Rab11a-Facilitated Exosomal Wnt10a Secretion and β-Catenin Signaling Activation |
Reviews
What customers say
The single review rates this antibody 4/5. It performed reasonably well in Western Blot at a 1:250 dilution but was not well suited for immunofluorescence at 1:100 in the U251-MG cell line. The reviewer suggested this may be due to a large fraction of soluble MARK2 protein, which can limit IF signal. Overall, it is a solid choice for WB but less reliable for IF in this particular cell type.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lucas (Verified Customer) (08-28-2025) | The antibody is working reasonably in WB, but is not really suitable for IF, at least in the U251-MG cell line. This could be due to a large fraction of soluble MARK2 protein.
|
