MAT2B Monoclonal antibody, PBS Only

• 

  WB analysis using 67643-1-Ig (same clone as 67643-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67643-1-Ig (MAT2B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67643-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67643-1-Ig (same clone as 67643-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67643-1-Ig (MAT2B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67643-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67643-1-Ig (same clone as 67643-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67643-1-Ig (MAT2B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67643-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67643-1-Ig (same clone as 67643-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67643-1-Ig (MAT2B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67643-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67643-1-Ig (same clone as 67643-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67643-1-Ig (MAT2B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67643-1-PBS in a different storage buffer formulation.

MAT2B Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67643-1-PBS

Clone No.2B7G8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

2B7G8, MAT II, MAT II beta, MATIIbeta, MSTP045

---

Product Information

67643-1-PBS targets MAT2B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8649

  Product name: Recombinant human MAT2B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-323 aa of BC005218

  Sequence: MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNTQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH

• Full Name: methionine adenosyltransferase II, beta
• Calculated Molecular Weight: 36 kDa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC005218
• Gene Symbol: MAT2B
• Gene ID (NCBI): 27430
• RRID: AB_2882843
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NZL9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.