MATCHF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MATCHF1 Polyclonal antibody, PBS Only (24771-1-PBS)

• 

  WB analysis using 24771-1-AP (same clone as 24771-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24771-1-AP (MATCHF1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24771-1-PBS in a different storage buffer formulation.

MATCHF1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24771-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24771-1-PBS targets MATCHF1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20231

  Product name: Recombinant human MARCH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 222-272 aa of BC153124

  Sequence: QNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGGPPEVVSV

• Full Name: membrane-associated ring finger (C3HC4) 1
• Calculated Molecular Weight: 289 aa, 32 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC153124
• Gene Symbol: MARCHF1
• Gene ID (NCBI): 55016
• RRID: AB_3085754
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TCQ1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MARCH1 is mainly found in secondary lymphoid organs, more specifically in the endocytic pathway of dendritic cells (DCs) and B cells (11-15). MARCH1 reduces the half-life of peptide/MHC II complexes by causing their redistribution from recycling endosomes to lysosomes. MARCH1 homodimerizes and also forms heterodimers with others family members (PMID: 22508929).