MATK Recombinant monoclonal antibody, PBS Only (Capture)

MATK Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85755-1-PBS
Clone No.250071G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

CTK, EC:2.7.10.2, Hematopoietic consensus tyrosine-lacking kinase, HYL, Megakaryocyte-associated tyrosine-protein kinase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85755-1-PBS targets MATK as part of a matched antibody pair:

MP02089-1: 85755-1-PBS capture and 85755-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0128

Product name: Recombinant human MATK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 118-402 aa of BC000114

Sequence: SLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFT

Predict reactive species
Full Name megakaryocyte-associated tyrosine kinase
Calculated Molecular Weight 56 kDa
Observed Molecular Weight55 kDa
GenBank Accession NumberBC000114
Gene Symbol MATK
Gene ID (NCBI) 4145
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42679
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MATK(Megakaryocyte-associated tyrosine-protein kinase) is also named as CTK, HYL and belongs to the protein kinase superfamily. This protein can can inhibit the kinase activity of certain Src kinase family members by phosphorylating the C-terminal tyrosine and by a non-catalytic mechanism. It may play an inhibitory role in the control of T-cell proliferation. MATK has 3 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...