MBD3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MBD3 Polyclonal antibody (14258-1-AP)

• Featured Product
• KD/KO Validated

MBD3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14258-1-AP Copied!

Publications (15)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

Synonyms

Methyl-CpG-binding protein MBD3, Methyl-CpG-binding domain protein 3, MBD 3

• 

  WB analysis of Y79 using 14258-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 14258-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 14258-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 14258-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 14258-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 14258-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14258-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 14258-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 14258-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14258-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 14258-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 14258-1-AP

  IP result of anti-MBD3 (IP:14258-1-AP, 4ug; Detection:14258-1-AP 1:800) with mouse testis tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 14258-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 14258-1-AP (MBD3 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 14258-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 14258-1-AP (MBD3 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14258-1-AP

  Immunofluorescent analysis of HepG2 cells, using MBD3 antibody 14258-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14258-1-AP

  Immunofluorescent analysis of HepG2 cells, using MBD3 antibody 14258-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MBD3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Y79 cells, COLO 320 cells, HeLa cells, Jurkat cells, MCF-7 cells, mouse testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14258-1-AP targets MBD3 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5531

  Product name: Recombinant human MBD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-259 aa of BC043619

  Sequence: MERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV

• Full Name: methyl-CpG binding domain protein 3
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC043619
• Gene Symbol: MBD3
• Gene ID (NCBI): 53615
• RRID: AB_2139745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95983
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MBD3 does not bind DNA by itself. It recruits histone deacetylases and DNA methyltransferases. MBD3 acts as transcriptional repressor and plays a role in gene silencing.(PMID:9774669) .

Publications

What published studies show

The MBD3 Polyclonal antibody (Cat# 14258-1-AP) has 15 citations. Journals include Nature Communications, PNAS, Journal of Experimental Medicine, Molecular Cancer, Nucleic Acids Research, Advanced Science, Medicine, Cancer Letters, Journal of Hematology & Oncology, Developmental Cell, Cancers, and Oncology Letters. Research fields span cancer biology (breast, gastric, colon, glioma, osteosarcoma, hepatocellular carcinoma), epigenetics and chromatin remodeling, reproductive biology, and immunology.

Automatically generated from the 15 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Hematol Oncol; Novel potent molecular glue degraders against broad range of hematological cancer cell lines via multiple neosubstrates degradation; Authors - Pengyun Li
human	WB,IP	Mol Cancer; Loss of TACC2 impairs chemokine CCL3 and CCL4 expression and reduces response to anti-PD-1 therapy in soft tissue sarcoma; Authors - Jing Yang
human	WB	Nat Commun; Low chorionic villous succinate accumulation associates with recurrent spontaneous abortion risk.; Authors - Xiao-Hui Wang ; KD Validated
human	WB	Nucleic Acids Res; CARM1 hypermethylates the NuRD chromatin remodeling complex to promote cell cycle gene expression and breast cancer development; Authors - Xue Chen
human	CoIP	Adv Sci (Weinh); Nuclear Translocation of S100A9 Triggers Senescence of Human Amnion Fibroblasts by De-Repressing LINE1 Via Heterochromatin Erosion at Parturition; Authors - Fan Zhang
human	WB,IHC	Med; Inactivation of TACC2 epigenetically represses CDKN1A and confers sensitivity to CDK inhibitors; Authors - Zhi-Rui Lin