MBL Polyclonal antibody

• 

  WB analysis using 32750-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32750-1-AP (Mbl2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 32750-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32750-1-AP (Mbl2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

MBL Polyclonal Antibody for WB, ELISA

Cat No. 32750-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

Mannan-binding protein, Mannose-binding protein C, Mbl2, MBP-C, RA-reactive factor P28A subunit

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse serum, rat plasma

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32750-1-AP targets MBL in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg3157

  Product name: Recombinant Mouse Mbl2 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-244 aa of NM_010776.1

  Sequence: ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

• Full Name: mannose-binding lectin (protein C) 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: NM_010776.1
• Gene Symbol: Mbl2
• Gene ID (NCBI): 17195
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P41317
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.