MBL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MBL Polyclonal antibody (32750-1-AP)

• 

  WB analysis using 32750-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32750-1-AP (Mbl2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 32750-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32750-1-AP (Mbl2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

MBL Polyclonal Antibody for WB, ELISA

Cat No. 32750-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

Mannan-binding protein, Mannose-binding protein C, Mbl2, MBP-C, RA-reactive factor P28A subunit

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse serum, rat plasma

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32750-1-AP targets MBL in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg3157

  Product name: Recombinant Mouse Mbl2 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-244 aa of NM_010776.1

  Sequence: ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

• Full Name: mannose-binding lectin (protein C) 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: NM_010776.1
• Gene Symbol: Mbl2
• Gene ID (NCBI): 17195
• RRID: AB_3742733
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P41317
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mannan-binding lectin (MBL) is a calcium-dependent (type C) serum lectin protein that is synthesized in the liver and circulates in the blood. It plays the role of a pattern recognition receptor in the innate immune system. It can recognize the carbohydrate structures on the surface of microorganisms and activate the lectin complement pathway through serine proteases related to mannan-binding lectins (MASPs), thereby achieving phagocytosis and inflammatory responses without the involvement of antibodies.(PMID: 16948640; 16395391)