Product Information
60544-3-PBS targets MCART1 as part of a matched antibody pair:
MP50768-2: 60544-3-PBS capture and 60544-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31357 Product name: Recombinant human MCART1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-50 aa of BC008500 Sequence: MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFP Predict reactive species |
| Full Name | mitochondrial carrier triple repeat 1 |
| GenBank Accession Number | BC008500 |
| Gene Symbol | MCART1 |
| Gene ID (NCBI) | 92014 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A Magarose purification |
| UNIPROT ID | Q9H1U9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

