MCHR1 Polyclonal antibody

• 

  WB analysis of SH-SY5Y using 11656-2-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 11656-2-AP (MCHR1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 11656-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11656-2-AP (MCHR1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 11656-2-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 11656-2-AP (MCHR1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 11656-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11656-2-AP (MCHR1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 11656-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11656-2-AP (MCHR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 11656-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11656-2-AP (MCHR1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 11656-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11656-2-AP (MCHR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MCHR1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11656-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

MCH receptor 1, MCH R1, MCH 1R, G-protein coupled receptor 24, GPR24

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells
• Positive IHC detected in: mouse heart tissue, human brain tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11656-2-AP targets MCHR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2224

  Product name: Recombinant human MCHR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-422 aa of BC021146

  Sequence: MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT

• Full Name: melanin-concentrating hormone receptor 1
• Calculated Molecular Weight: 422 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC021146
• Gene Symbol: MCHR1
• Gene ID (NCBI): 2847
• RRID: AB_2143940
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99705
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.