• Featured Product
  • KD/KO Validated

MCL1 Recombinant monoclonal antibody, PBS Only

MCL1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA
Cat No. 82695-2-PBS
Clone No.1C7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

1C7, Bcl2-L-3, Bcl-2-like protein 3, Bcl-2-related protein EAT/mcl1, EAT

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82695-2-PBS targets MCL1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10397

Product name: Recombinant human MCL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-327 aa of BC107735

Sequence: MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG

Predict reactive species
Full Name myeloid cell leukemia sequence 1 (BCL2-related)
Calculated Molecular Weight 350 aa, 37 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberBC107735
Gene Symbol MCL1
Gene ID (NCBI) 4170
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ07820
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MCL-1 is an anti-apoptotic member of the Bcl-2 family originally isolated from the ML-1 human myeloid leukemia cell line. Similar to BCL2 and BCL2L1, MCL1 can interact with BAX and/or BAK1 to inhibit mitochondria-mediated apoptosis. Mcl-1 is critical for the proliferation and survival of myeloma cells in vitro, and overexpression of Mcl-1 protein in myeloma cells is associated with relapse and short event-free survival in multiple myeloma patients. Recent studies show that MCL-1 is upregulated in numerous haematological and solid tumour malignancies. Therefore, MCL-1 has been suggested as a potential new therapeutic target. MCL-1 can be alternatively spliced into a long form (MCL-1L, 40 kDa) or a short form (MCL-1S, 30 kDa). (PMID: 15467463, PMID: 15147382)

Loading...
||
New chat Able
正在加载,请稍候...