Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-22787 targets MCT4 in IF/ICC, FC (Intra) applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18788 Product name: Recombinant human SLC16A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 402-465 aa of BC112269 Sequence: LLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV Predict reactive species |
| Full Name | solute carrier family 16, member 3 (monocarboxylic acid transporter 4) |
| Calculated Molecular Weight | 465 aa, 49 kDa |
| Observed Molecular Weight | 38-42 kDa |
| GenBank Accession Number | BC112269 |
| Gene Symbol | MCT4 |
| Gene ID (NCBI) | 9123 |
| RRID | AB_3084070 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15427 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The monocarboxylate transporter 4 (MCT4, also known as SLC16A3) is involved in the transportation of metabolically important monocarboxylates such as lactate, pyruvate, acetate and ketone bodies. It is widely expressed, particularly strongly in glycolytic tissues such as white skeletal muscle fibres, astrocytes, white blood cells, chondrocytes and some mammalian cell lines. MCT4 is also linked to tumor biology because it mediates lactate transport across membranes resulting in antiapoptotic effects.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 MCT4 antibody CL488-22787 | Download protocol |
| IF protocol for CL Plus 488 MCT4 antibody CL488-22787 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



