Tested Applications
Positive WB detected in | HeLa cells, rat skeletal muscle tissue, HepG2 cells, PC-3 cells |
Positive IHC detected in | human lung cancer tissue, human breast cancer tissue, human prostate cancer tissue, human renal cell carcinoma tissue, human skeletal muscle tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:20000 |
Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 10 publications below |
WB | See 69 publications below |
IHC | See 13 publications below |
IF | See 16 publications below |
IP | See 1 publications below |
Product Information
22787-1-AP targets MCT4 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, goat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18788 Product name: Recombinant human SLC16A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 402-465 aa of BC112269 Sequence: LLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV Predict reactive species |
Full Name | solute carrier family 16, member 3 (monocarboxylic acid transporter 4) |
Calculated Molecular Weight | 465 aa, 49 kDa |
Observed Molecular Weight | 38-42 kDa |
GenBank Accession Number | BC112269 |
Gene Symbol | MCT4 |
Gene ID (NCBI) | 9123 |
RRID | AB_11182479 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O15427 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The monocarboxylate transporter 4 (MCT4, also known as SLC16A3) is involved in the transportation of metabolically important monocarboxylates such as lactate, pyruvate, acetate and ketone bodies. It is widely expressed, particularly strongly in glycolytic tissues such as white skeletal muscle fibres, astrocytes, white blood cells, chondrocytes and some mammalian cell lines. MCT4 is also linked to tumor biology because it mediates lactate transport across membranes resulting in antiapoptotic effects.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MCT4 antibody 22787-1-AP | Download protocol |
IHC protocol for MCT4 antibody 22787-1-AP | Download protocol |
IF protocol for MCT4 antibody 22787-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Metab Acetate enables metabolic fitness and cognitive performance during sleep disruption | ||
Nat Cancer Targeting the bicarbonate transporter SLC4A4 overcomes immunosuppression and immunotherapy resistance in pancreatic cancer | ||
Nat Metab Lactylome analysis suggests lactylation-dependent mechanisms of metabolic adaptation in hepatocellular carcinoma
| ||
Adv Sci (Weinh) SETDB1 Methylates MCT1 Promoting Tumor Progression by Enhancing the Lactate Shuttle | ||
Dev Cell Lactate shuttling links histone lactylation to adult hippocampal neurogenesis in mice |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Aderonke (Verified Customer) (05-26-2023) | Immunoblotting was done to show the expression of MCT 4 in five head and neck cancer cell lines; only three of the five cell lines demonstrated this. An inhibitor was thereafter used at two differenct concentrations in UM-SCC-17A, and the expression decreased with increasing concentrations.
|
FH Juan (Verified Customer) (07-15-2019) | We used the antibody for WB method. The band backgound is clear.
|