MCTS1 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse bladder using 84312-5-RR (same clone as 84312-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 84312-5-RR (MCTS1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84312-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse bladder using 84312-5-RR (same clone as 84312-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 84312-5-RR (MCTS1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84312-5-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 84312-5-RR (same clone as 84312-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using MCTS1 antibody (84312-5-RR, Clone: 241576H1 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84312-5-PBS in a different storage buffer formulation.

MCTS1 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 84312-5-PBS

Clone No.241576H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Multiple copies T-cell malignancies, MCT-1, MCT1, Malignant T-cell-amplified sequence 1, 241576H1

---

Product Information

84312-5-PBS targets MCTS1 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6968

  Product name: Recombinant human MCTS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC001013

  Sequence: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK

• Full Name: malignant T cell amplified sequence 1
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC001013
• Gene Symbol: MCTS1
• Gene ID (NCBI): 28985
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9ULC4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MCTS1 is an anti-oncogene that plays a role in cell cycle regulation. It can reduce cell doubling time and anchor-dependent growth. The G1 transition time and the duration of the G1 / S transition are shortened. It can also promote the release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (PMID: 10440924).