MDFIC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MDFIC Polyclonal antibody, PBS Only (31740-1-PBS)

• 

  IP experiment of Kasumi-1 using 31740-1-AP (same clone as 31740-1-PBS)

  IP result of anti-MDFIC (IP:31740-1-AP, 4ug; Detection:31740-1-AP 1:500) with Kasumi-1 cells lysate 1320 ug. This data was developed using the same antibody clone with 31740-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 31740-1-AP (same clone as 31740-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using MDFIC antibody (31740-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31740-1-PBS in a different storage buffer formulation.

MDFIC Polyclonal Antibody for IF/ICC, IP, Indirect ELISA

Cat No. 31740-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, IP, Indirect ELISA

Synonyms

HIC, I-mfa domain-containing protein, LMPHM12, MyoD family inhibitor domain-containing protein

---

Product Information

31740-1-PBS targets MDFIC in IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35437

  Product name: Recombinant human MDFIC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of NM_001166345

  Sequence: MSGAGEALAPGPVGPQRVAEAGGGQLGSTAQGKCDKDNTEKDITQATNSHFTHGEMQDQSIWGNPSDGELIRTQPQRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADNRKLSAPVSQKMHRKIQSSLSVNSDISKKSKVNAVFSQKTGSSPEDCCVHC

• Full Name: MyoD family inhibitor domain containing
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: NM_001166345
• Gene Symbol: MDFIC
• Gene ID (NCBI): 29969
• RRID: AB_3742468
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9P1T7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MDFIC encodes the MyoD family inhibitor domain containing protein, a 246-amino acid protein documented to regulate the activity of transcription factors including the glucocorticoid recep tor (GR), HAND1, and T cell factor/lymphoid enhancer factor (TCF/LEF) family members. The C-terminal region of MDFIC harbors a domain extremely rich in cysteine residues, reported to mediate protein-protein interactions between MDFIC and transcription factor componentry (PMID: 35235341).