MDH1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP01422-2

  Sandwich ELISA standard curve of MP01422-2, Human MDH1 Recombinant Matched Antibody Pair - PBS only. 84576-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag8744. 84576-2-PBS was HRP conjugated as the detection antibody. Range: 0.391-25 ng/mL.

• 

  Sample test of MP01422-2

  Serum of six individual healthy human donors was measured. The MDH1 concentration of detected samples was determined to be 92.63 ng/mL with a range of 59.50-142.37 ng/mL.

• 

  Sample test of MP01422-2

  The mean MDH1 concentration was determined to be 2187.75 ng/mL in HepG2 cell extract based on a 2.30 mg/mL extract load and 1287.87 ng/mL in HEK-293 cell extract based on a 1.50 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP01422-2

  Cytometric bead array standard curve of MP01422-2, MDH1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84576-1-PBS. Detection antibody: 84576-2-PBS. Standard: Ag8744. Range: 0.781-100 ng/mL.

MDH1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84576-1-PBS

Clone No.241887C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Aromatic alpha-keto acid reductase, EC:1.1.1.37, EC:1.1.1.96, KAR, MDHA

---

Product Information

84576-1-PBS targets MDH1 as part of a matched antibody pair:

MP01422-2: 84576-1-PBS capture and 84576-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8744

  Product name: Recombinant human MDH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-334 aa of BC001484

  Sequence: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

• Full Name: malate dehydrogenase 1, NAD (soluble)
• Calculated Molecular Weight: 334 aa, 36 kDa
• GenBank Accession Number: BC001484
• Gene Symbol: MDH1
• Gene ID (NCBI): 4190
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40925
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.