Tested Applications
| Positive WB detected in | HeLa cells, mouse liver tissue, mouse placenta tissue, MCF-7 cells, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16619-1-AP targets ME1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9916 Product name: Recombinant human ME1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 226-572 aa of BC025246 Sequence: DEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ Predict reactive species |
| Full Name | malic enzyme 1, NADP(+)-dependent, cytosolic |
| Calculated Molecular Weight | 572 aa, 64 kDa |
| Observed Molecular Weight | 55-64 kDa |
| GenBank Accession Number | BC025246 |
| Gene Symbol | ME1 |
| Gene ID (NCBI) | 4199 |
| RRID | AB_2143821 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48163 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ME1(NADP-dependent malic enzyme) belongs to the malic enzymes family. This malic enzyme catalyzes the reversible oxidative decarboxylation of malate and is a link between the glycolytic pathway and the citric acid cycle. The reaction is L-malate plus NADP(+) to form pyruvate, CO(2), and NADPH. The predicted protein contains 572 amino acids and has a calculated molecular mass of 64.1 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ME1 antibody 16619-1-AP | Download protocol |
| IHC protocol for ME1 antibody 16619-1-AP | Download protocol |
| IP protocol for ME1 antibody 16619-1-AP | Download protocol |
| WB protocol for ME1 antibody 16619-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
16619-1-AP (anti-Malic Enzyme 1/ME1) has 32 citations in journals including Cancer Cell, Nature Metabolism, Nature Communications, Molecular Cell, Cell Reports, and eLife. Research fields cover metabolic reprogramming, cancer biology, ferroptosis, lipid metabolism, redox homeostasis, NADPH metabolism, liver injury, and immune regulation, with applications primarily in Western blot, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Cancer Cell Nrf2 redirects glucose and glutamine into anabolic pathways in metabolic reprogramming. | ||
Cell Res cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. | ||
Nat Metab Non-oxidative pentose phosphate pathway controls regulatory T cell function by integrating metabolism and epigenetics. | ||
Nat Commun Elevating cytosolic NADPH metabolism in endothelial cells ameliorates vascular aging. | ||
Mol Cell Dynamic Regulation of ME1 Phosphorylation and Acetylation Affects Lipid Metabolism and Colorectal Tumorigenesis. | ||
Adv Sci (Weinh) Malic Enzyme 1 as a Novel Anti-Ferroptotic Regulator in Hepatic Ischemia/Reperfusion Injury |
Reviews
What customers say
The single review reports a 5-star rating for Western Blot. The user tested the antibody at a 1:1000 dilution on liver cancer samples and found it performed well with no background. The reviewer noted they had first encountered the antibody in a published study before testing it themselves, and confirmed it works great in WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Chi (Verified Customer) (10-17-2024) | I have found the antibody in a publication (https://pubmed.ncbi.nlm.nih.gov/22789539/) and have tested the antibody myself. The antibody works great in WB with no background.
|
