Mouse MECR Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84729-4-RR (same clone as 84729-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84729-4-RR (MECR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84729-4-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 84729-4-RR (same clone as 84729-4-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 84729-4-RR (MECR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84729-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 84729-4-RR (same clone as 84729-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 84729-4-RR (MECR antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84729-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 84729-4-RR (same clone as 84729-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 84729-4-RR (MECR antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84729-4-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 84729-4-RR (same clone as 84729-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using MECR antibody (84729-4-RR, Clone: 242151C5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84729-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84729-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84729-4-RR against Mouse MECR were performed. The affinity constant is below 1 pM.

MECR Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84729-4-PBS

Clone No.242151C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

242151C5, 2-enoyl thioester reductase, EC:1.3.1.104, Enoyl-[acyl-carrier-protein] reductase, mitochondrial, Nrbf1

---

Product Information

84729-4-PBS targets MECR in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0465

  Product name: Recombinant mouse Mecr protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 117-373 aa of BC003864

  Sequence: SSVSALKPGDWVIPANAGLGTWRTEAVFSEEALIGIPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALRLKTINVVRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKTIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSLLIFKDLKLRGFWLSQWKKNHSPDEFKELILTLCNLIRQGRLTAPSCSEVPLQGYQQALEASMKPFVSSKQILTM

• Full Name: mitochondrial trans-2-enoyl-CoA reductase
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC003864
• Gene Symbol: MECR
• Gene ID (NCBI): 26922
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9DCS3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mitochondrial 2-enoyl-acyl-carrier protein reductase (MECR) is an enzyme in the mitochondrial fatty acid synthase (mtFAS) pathway. MECR is involved in the synthesis of lipoic acid and is required for mitochondrial respiratory competence. MECR is highly expressed in skeletal and heart muscles and exhibits lower expression in placenta, liver, kidney, and pancreas. It is weakly expressed or not expressed in the lung (PMID: 32440681, PMID: 37734847, PMID: 38296034).