MED1 Polyclonal antibody

• 

MED1 Polyclonal Antibody for ELISA

Cat No. 14091-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

ARC205, CRSP1, CRSP200, DRIP205, DRIP230, MED1, mediator complex subunit 1, p53 regulatory protein RB18A, PBP, PPAR binding protein, PPARBP, PPARGBP, RB18A, TR interacting protein 2, TRAP220, TRIP 2, TRIP2

---

Product Information

14091-1-AP targets MED1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5222

  Product name: Recombinant human MED1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 207-556 aa of BC060758

  Sequence: SVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGSKNPELGSG

• Full Name: mediator complex subunit 1
• Calculated Molecular Weight: 556 aa, 62 kDa
• GenBank Accession Number: BC060758
• Gene Symbol: MED1
• Gene ID (NCBI): 5469
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15648
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.