MED19 Polyclonal antibody

• 

  WB analysis of human testis using 13418-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 13418-1-AP (MED19 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 13418-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13418-1-AP (MED19 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 13418-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13418-1-AP (MED19 Antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

MED19 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13418-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

DT2P1G7, LCMR1, MED19, mediator complex subunit 19

---

Tested Applications

• Positive WB detected in: human testis tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

13418-1-AP targets MED19 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4165

  Product name: Recombinant human MED19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-194 aa of BC037223

  Sequence: MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS

• Full Name: mediator complex subunit 19
• Calculated Molecular Weight: 194 aa, 20 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC037223
• Gene Symbol: MED19
• Gene ID (NCBI): 219541
• RRID: AB_10644134
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A0JLT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mediator of RNA polymerase II transcription subunit 19 (MED19) is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (PMID: 12584197). Mediator complex is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors (PMID: 15175163). MED19 may be a novel proliferation regulator that promotes lung cancer and gastric cancer progression and cellular growth (PMID: 21519921, PMID: 22565189).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Biochem; Med19 is involved in chemoresistance by mediating autophagy through HMGB1 in breast cancer.; Authors - Beibei Liu ; KD Validated
human	WB	J Biochem Mol Toxicol; Chloroprocaine antagonizes progression of breast cancer by regulating LINC00494/miR-3619-5p/MED19 axis; Authors - Chen Chen
rat	IHC,WB	Int J Nanomedicine; Hypoxic Bone Mesenchymal Stem Cell-Derived Exosomes Direct Schwann Cells Proliferation, Migration, and Paracrine to Accelerate Facial Nerve Regeneration via circRNA_Nkd2/miR-214-3p/MED19 Axis; Authors - Haopeng Wang
		Mol Cell; The phosphatase PP1 sustains global transcription by promoting RNA polymerase II pause release; Authors - Zhenning Wang