MED22 Polyclonal antibody

• 

MED22 Polyclonal Antibody for ELISA

Cat No. 16704-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

MED22, MED24, mediator complex subunit 22, Surf 5, SURF5, Surfeit locus protein 5

---

Product Information

16704-1-AP targets MED22 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10102

  Product name: Recombinant human MED22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of BC024225

  Sequence: MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK

• Full Name: mediator complex subunit 22
• Calculated Molecular Weight: 140aa,16 kDa; 200aa,22 kDa
• GenBank Accession Number: BC024225
• Gene Symbol: MED22
• Gene ID (NCBI): 6837
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15528
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.