MED23 Polyclonal antibody

• 

  WB analysis using 27850-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27850-1-AP (MED23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 27850-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 27850-1-AP (MED23 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 27850-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 27850-1-AP (MED23 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MED23 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27850-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

MED23/CRSP3, CRSP133, CRSP130, CRSP complex subunit 3, Cofactor required for Sp1 transcriptional activation subunit 3

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, A375 cells, U2OS cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27850-1-AP targets MED23 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27241

  Product name: Recombinant human MED23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 745-1059 aa of BC060759

  Sequence: QNNVPQESRFNLKKNVEEEYRKWKSMSNENDIITHFSMQGSPPLFLCLLWKMLLETDHINQIGYRVLERIGARALVAHVRTFADFLVYEFSTSAGGQQLNKCIEILNDMVWKYNIVTLDRLILCLAMRSHEGNEAQVCYFIIQLLLLKPNDFRNRVSDFVKENSPEHWLQNDWHTKHMNYHKKYPEKLYFEGLAEQVDPPVQIQSPYLPIYFGNVCLRFLPVFDIVIHRFLELLPVSKSLETLLDHLGGLYKFHDRPVTYLYNTLHYYEMHLRDRAFLKRKLVHAIIGSLKDNRPQGWCLSDTYLKCAMNAREEN

• Full Name: mediator complex subunit 23
• Calculated Molecular Weight: 156 kDa
• Observed Molecular Weight: 140 kDa, 50 kDa
• GenBank Accession Number: BC060759
• Gene Symbol: MED23
• Gene ID (NCBI): 9439
• RRID: AB_2880994
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULK4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MED23 is a component of the Mediator complex, it is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Rep; DDB1 binds histone reader BRWD3 to activate the transcriptional cascade in adipogenesis and promote onset of obesity.; Authors - Xu Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

SITING (Verified Customer) (04-02-2021)

not very good， too many unspecific band

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: EMBRYO HEART

MED23 Antibody Western Blot validation (1:500 dilution) in EMBRYO HEART (Cat no:27850-1-AP)