MED26 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MED26 Polyclonal antibody (21043-1-AP)

• Featured Product
• KD/KO Validated

MED26 Polyclonal Antibody for WB, ELISA

Cat No. 21043-1-AP Copied!

Publications (3)

Reviews (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Activator-recruited cofactor 70 kDa component, ARC70, CRSP7, CRSP70

• 

  WB analysis using 21043-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21043-1-AP (MED26 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse ovary using 21043-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 21043-1-AP (MED26 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 21043-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21043-1-AP (MED26 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MED26 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse ovary tissue, HEK-293 cells, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21043-1-AP targets MED26 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15381

  Product name: Recombinant human MED26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 251-600 aa of BC110430

  Sequence: QQLDRVDETPGPPHPKGPPRCSFSPRNSRHEGSFARQQSLYAPKGSVPSPSPRPQALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSLAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIKPLTQKEPVRADSPVHMEQQSRTELDKQEAKASLQSPFEQTNWKELSRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD

• Full Name: mediator complex subunit 26
• Calculated Molecular Weight: 600 aa, 65 kDa
• Observed Molecular Weight: 66-70 kDa
• GenBank Accession Number: BC110430
• Gene Symbol: MED26
• Gene ID (NCBI): 9441
• RRID: AB_10733342
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95402
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MED26 (Mediator complex subunit 26), also known as ARC70 or CRSP7, is a metazoan-specific Mediator subunit essential for transcription regulation. MED26 plays a critical role in the transition from transcription initiation to elongation. It acts as a molecular switch, with its conserved N-terminal domain facilitating the exchange of the initiation factor TFIID for the super elongation complex (SEC), which contains factors such as ELL/EAF and P-TEFb, thereby promoting RNA polymerase II elongation (PMID: 21729782, PMID: 33836240).

Publications

What published studies show

The MED26 Polyclonal antibody (Cat# 21043-1-AP) has 3 citations published in Nucleic Acids Research, Retrovirology, and bioRxiv. The cited research spans transcription regulation—specifically RNA polymerase II elongation and P-TEFb function—and retroviral biology, focusing on Gag–host cell nuclear interactome interactions. All citations used the antibody for Western blot (WB) applications in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; Multiple P-TEFbs cooperatively regulate the release of promoter-proximally paused RNA polymerase II.; Authors - Xiaodong Lu ; KD Validated
	WB	Retrovirology; Comparative analysis of retroviral Gag-host cell interactions: focus on the nuclear interactome; Authors - Gregory S Lambert
	WB	bioRxiv; Comparative analysis of retroviral Gag-host cell interactions: focus on the nuclear interactome; Authors - Gregory S Lambert

Reviews

4.0 out of 5

2 verified customer reviews

What customers say

Both reviews rate the antibody 4 stars for Western Blot. One user, using a 1:500 dilution on mouse heart tissue, reported a clear band. The other, also at 1:500 on embryonic heart, found performance "not very good in our system." Overall, results are mixed: the antibody can produce clear bands in some applications, but performance may vary depending on the specific experimental system and tissue type.

Automatically generated from the 2 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

siting (Verified Customer) (06-24-2021)

clear band

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: mice heart

MED26 Antibody Western Blot validation (1:500 dilution) in mice heart (Cat no:21043-1-AP)

SITING (Verified Customer) (05-25-2021)

not very good in our system

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: EMBRYO HEART

MED26 Antibody Western Blot validation (1:500 dilution) in EMBRYO HEART (Cat no:21043-1-AP)