MED4 Monoclonal antibody, PBS Only

• 

  WB analysis using 67839-1-Ig (same clone as 67839-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67839-1-Ig (MED4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67839-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67839-1-Ig (same clone as 67839-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67839-1-Ig (MED4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67839-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67839-1-Ig (same clone as 67839-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MED4 antibody (67839-1-Ig, Clone: 2E6F4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). DAPI (Blue). This data was developed using the same antibody clone with 67839-1-PBS in a different storage buffer formulation.

MED4 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67839-1-PBS

Clone No.2E6F4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ARC36, DRIP36, FLJ10956, HSPC126, MED4, mediator complex subunit 4, RP11 90M2.2, TRAP36, VDRIP

---

Product Information

67839-1-PBS targets MED4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, rat samples.

• Tested Reactivity: Human, Mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8562

  Product name: Recombinant human MED4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-270 aa of BC005189

  Sequence: MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD

• Full Name: mediator complex subunit 4
• Calculated Molecular Weight: 270 aa, 30 kDa
• Observed Molecular Weight: ~36 kDa
• GenBank Accession Number: BC005189
• Gene Symbol: MED4
• Gene ID (NCBI): 29079
• RRID: AB_2918601
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NPJ6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MED4 is a component of the Meditor complex, which is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Meditor functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. It also have an alternative name called "Activator-recruited cofactor 36 kDa component (ARC36) ".