MED7 Polyclonal antibody

• 

  WB analysis using 33458-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33458-1-AP (MED7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

MED7 Polyclonal Antibody for WB, ELISA

Cat No. 33458-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Mediator complex subunit 7, Activator-recruited cofactor 34 kDa component, ARC34, Cofactor required for Sp1 transcriptional activation subunit 9, CRSP complex subunit 9

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-3 cells, Daudi cells, MG-63 cells, PC-3 cells, T-47D cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33458-1-AP targets MED7 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38214

  Product name: Recombinant human MED7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-233 aa of BC006968

  Sequence: MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP

• Full Name: mediator complex subunit 7
• Calculated Molecular Weight: 233 aa, 27 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC006968
• Gene Symbol: MED7
• Gene ID (NCBI): 9443
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O43513
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MED7 is a crucial subunit of the Mediator complex, a protein complex that regulates gene transcription by interacting with RNA polymerase II.