MEF2A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MEF2A Polyclonal antibody, PBS Only (28819-1-PBS)

• 

  WB analysis using 28819-1-AP (same clone as 28819-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28819-1-AP (MEF2A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28819-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 28819-1-AP (same clone as 28819-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28819-1-AP (MEF2A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28819-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 28819-1-AP (same clone as 28819-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28819-1-AP (MEF2A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28819-1-PBS in a different storage buffer formulation.

MEF2A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28819-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28819-1-PBS targets MEF2A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30349

  Product name: Recombinant human MEF2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 126-258 aa of BC013437

  Sequence: MRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPP

• Full Name: myocyte enhancer factor 2A
• Calculated Molecular Weight: 499 aa, 54 kDa
• Observed Molecular Weight: 50-70kDa
• GenBank Accession Number: BC013437
• Gene Symbol: MEF2A
• Gene ID (NCBI): 4205
• RRID: AB_3086086
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02078
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MEF2A belongs to a family of DNA binding regulatory proteins. Each of these proteins which belong to the myocyte-specific enhancer factor-2 (MEF2) family binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. MEF2A plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. MEF2A also has key roles in cardiac and skeletal muscle development. MEF2A is especially abundant in granule neurons of the cerebellar cortex throughout the period of synaptogenesis. This antibody can detect two bands around 60 kDa to 70 kDa, the larger band may correspond to its post-translational modifications.(PMID: 15483225,16484498, 23486945 )