Filter: AllWBIHC

WB analysis of human brain using 10931-1-AP (same clone as 10931-1-PBS)
human brain tissue were subjected to SDS PAGE followed by western blot with 10931-1-AP (MEF2BNB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10931-1-PBS in a different storage buffer formulation.
IHC staining of human lymphoma using 10931-1-AP (same clone as 10931-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10931-1-AP (MEF2BNB Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10931-1-PBS in a different storage buffer formulation.
IHC staining of human lymphoma using 10931-1-AP (same clone as 10931-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10931-1-AP (MEF2BNB Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10931-1-PBS in a different storage buffer formulation.

MEF2BNB Polyclonal antibody, PBS Only

Name: MEF2BNB Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 10931-1-PBS

MEF2BNB Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10931-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

10931-1-PBS targets MEF2BNB in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1370 Product name: Recombinant human MEF2BNB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC010931 Sequence: MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHSPEEPPPPSSA Predict reactive species
Full Name	hypothetical protein LOC729991
Calculated Molecular Weight	13 kDa
Observed Molecular Weight	12-15 kDa, 32 kDa
GenBank Accession Number	BC010931
Gene Symbol	MEF2BNB
Gene ID (NCBI)	729991
RRID	AB_530408
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q96FH0
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™