MEI4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MEI4 Polyclonal antibody, PBS Only (29892-1-PBS)

• 

  WB analysis using 29892-1-AP (same clone as 29892-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 29892-1-AP (MEI4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 29892-1-AP (same clone as 29892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29892-1-AP (MEI4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 29892-1-AP (same clone as 29892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29892-1-AP (MEI4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29892-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 29892-1-AP (same clone as 29892-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using MEI4 antibody (29892-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29892-1-PBS in a different storage buffer formulation.

MEI4 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 29892-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Meiosis-specific protein MEI4

---

Product Information

29892-1-PBS targets MEI4 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31859

  Product name: Recombinant human MEI4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-186 aa of NM_001322247.1

  Sequence: MDVQKWYLRTSKLALALAIIRSKPADKSSREYTEHLAMLLSEEQSKWRSKVEILEAEVMQLRQKLLVSRLCSGSFKSGYVSSQLEAQEPKSSESTLTSMEDSGCDLSNEQRTESSDLSQHFVESCTPTHFPPLPLVKRPCAILQNPLSSHMQFLQYLLELKNLTESGNLKRDLTHFEKDSSTVSDS*

• Full Name: Meiosis-specific protein MEI4
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_001322247.1
• Gene Symbol: MEI4
• Gene ID (NCBI): 101928601
• RRID: AB_3086182
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A8MW99
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.