MEIKIN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MEIKIN Polyclonal antibody (31759-1-AP)

• 

  IHC staining of human placenta using 31759-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31759-1-AP (MEIKIN antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 31759-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using MEIKIN antibody (31759-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MDCK using 31759-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MDCK cells using MEIKIN antibody (31759-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

MEIKIN Polyclonal Antibody for IHC, IF/ICC, IF-P, ELISA

Cat No. 31759-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, IF-P, ELISA

Synonyms

LOC728637, similar to mCG13783

---

Tested Applications

• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue
• Positive IF/ICC detected in: MDCK cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31759-1-AP targets MEIKIN in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36937

  Product name: Recombinant human MEIKIN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of NM_001303622

  Sequence: MWPLRVYTRKKREGQRLNLTPTPDLGSPAKAEAPPGSKRKGKVHGLSKIAEKAERSRQGGSGSGPFSPRLGVTGEKSLQENRSSEDTQDEKIASLRESVTDDLQVDSSSSNSE

• Full Name: similar to mCG13783
• Calculated Molecular Weight: 373aa, 41 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_001303622
• Gene Symbol: LOC728637
• Gene ID (NCBI): 728637
• RRID: AB_3742474
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A0A087WXM9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Meikin is a conservative regulatory protein that plays a key role in meiosis. It was first discovered in mice. It is a meiotic-specific centromere protein and was named Meikin because of its important role in meiosis. Meikin's function is mainly realized by regulating the activity of Polo-like kinase PLK1. PLK1 is enriched to centromere under Meikin's dependence, which further affects the function of centromere.