MEIS3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MEIS3 Polyclonal antibody (12775-1-AP)

MEIS3 Polyclonal Antibody for WB, ELISA

Cat No. 12775-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Homeobox protein Meis3, Meis homeobox 3, Meis1 related protein 2, MEIS3, MRG2

• 

  WB analysis using 12775-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12775-1-AP (MEIS3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12775-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 12775-1-AP (MEIS3 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MEIS3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, A549 cells, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12775-1-AP targets MEIS3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3471

  Product name: Recombinant human MEIS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 76-421 aa of BC025404

  Sequence: CELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDCGRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL

• Full Name: Meis homeobox 3
• Calculated Molecular Weight: 421 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC025404
• Gene Symbol: MEIS3
• Gene ID (NCBI): 56917
• RRID: AB_10639519
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99687
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MEIS3, also known as MRG2, belongs to the TALE/MEIS homeobox family. MEIS3 encodes a homeobox domain, so it can bind to DNA, regulate specific DNA sequence binding, and promote transcription activity. MEIS3 has 3 isoforms with the molecular mass of 39, 41, and 46 kDa (PMID: PMID: 33376716).

Publications

What published studies show

The MEIS3 Polyclonal antibody (Cat# 12775-1-AP) has 1 publication citation. It appears in Molecular Systems Biology (IF 6.7), in a study investigating gene regulatory networks controlling the balance between mesendoderm and ectoderm at pluripotency exit. The research falls within the fields of developmental biology and stem cell biology, with the antibody used for Western blot in mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Syst Biol; A gene regulatory network controls the balance between mesendoderm and ectoderm at pluripotency exit.; Authors - Hanna L Sladitschek