MEIS3 Polyclonal antibody

• 

  WB analysis using 12775-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12775-1-AP (MEIS3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12775-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 12775-1-AP (MEIS3 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

MEIS3 Polyclonal Antibody for WB, ELISA

Cat No. 12775-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Homeobox protein Meis3, Meis homeobox 3, Meis1 related protein 2, MEIS3, MRG2

---

Tested Applications

• Positive WB detected in: mouse liver tissue, A549 cells, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12775-1-AP targets MEIS3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3471

  Product name: Recombinant human MEIS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 76-421 aa of BC025404

  Sequence: CELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDCGRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL

• Full Name: Meis homeobox 3
• Calculated Molecular Weight: 421 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC025404
• Gene Symbol: MEIS3
• Gene ID (NCBI): 56917
• RRID: AB_10639519
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99687
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MEIS3, also known as MRG2, belongs to the TALE/MEIS homeobox family. MEIS3 encodes a homeobox domain, so it can bind to DNA, regulate specific DNA sequence binding, and promote transcription activity. MEIS3 has 3 isoforms with the molecular mass of 39, 41, and 46 kDa (PMID: PMID: 33376716).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Syst Biol; A gene regulatory network controls the balance between mesendoderm and ectoderm at pluripotency exit.; Authors - Hanna L Sladitschek