MELK Recombinant monoclonal antibody

• 

  FC experiment of MCF-7 using 82893-1-RR

  1x10^6 MCF-7 cells were intracellularly stained with 0.5 ug Anti-Human MELK (82893-1-RR, Clone:230106D4) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:166 (red), or 0.5 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP, Clone: ) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• 

  Affinity and Kinetic Characterization of 82893-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82893-1-RR against Human MELK were performed. The affinity constant is below 1 pM.

MELK Uni-rAb^® Recombinant Antibody for FC (Intra), ELISA

Cat No. 82893-1-RR

Clone No.230106D4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra), ELISA

Synonyms

KIAA0175, hPK38, hMELK, EC:2.7.11.1, EC:2.7.10.2

---

Tested Applications

• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82893-1-RR targets MELK in FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1897

  Product name: Recombinant human MELK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 302-651 aa of BC014039

  Sequence: EDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV

• Full Name: maternal embryonic leucine zipper kinase
• Calculated Molecular Weight: 651 aa, 75 kDa
• GenBank Accession Number: BC014039
• Gene Symbol: MELK
• Gene ID (NCBI): 9833
• RRID: AB_3670618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14680
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MELK is involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. It also plays a key role in cell proliferation and carcinogenesis, and it is required for proliferation of embryonic and postnatal multipotent neural progenitors.