MEMO1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MEMO1 Polyclonal antibody, PBS Only (14604-1-PBS)

• 

  WB analysis using 14604-1-AP (same clone as 14604-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14604-1-AP (MEMO1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14604-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 14604-1-AP (same clone as 14604-1-PBS)

  WB result of MEMO1 antibody (14604-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MEMO1 transfected A549 cells. This data was developed using the same antibody clone with 14604-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 14604-1-AP (same clone as 14604-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14604-1-AP (MEMO1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14604-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 14604-1-AP (same clone as 14604-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 14604-1-AP (MEMO1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14604-1-PBS in a different storage buffer formulation.

• 

  IF Staining of BxPC-3 using 14604-1-AP (same clone as 14604-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed BxPC-3 cells using MEMO1 antibody (14604-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 14604-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MEMO1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 14604-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

HCV NS5A-transactivated protein 7, CGI-27, CGI27, CGI 27, C2orf4

---

Product Information

14604-1-PBS targets MEMO1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6151

  Product name: Recombinant human MEMO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-297 aa of BC070046

  Sequence: MSNRVVCREASHAGSWYTASGPHLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH

• Full Name: mediator of cell motility 1
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 31-34 kDa
• GenBank Accession Number: BC070046
• Gene Symbol: MEMO1
• Gene ID (NCBI): 51072
• RRID: AB_2297647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y316
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.