MER34 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MER34 Recombinant monoclonal antibody, PBS Only (86925-1-PBS)

• 

  WB analysis using 86925-1-RR (same clone as 86925-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86925-1-RR (MER34 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86925-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86925-1-RR (same clone as 86925-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86925-1-RR (MER34 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86925-1-PBS in a different storage buffer formulation.

MER34 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86925-1-PBS

Clone No.251958G6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ERVMER34

---

Product Information

86925-1-PBS targets MER34 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6066

  Product name: Recombinant human MER34 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-488 aa of NM_001242690.2

  Sequence: LLAPVFRTLSILTNQSNCWLCEHLDNAEQPELVFVPASASTWWTYSGQWMYERVWYPQAEVQNHSTSSYRKVTWHWEASMEAQGLSFAQVRLLEGNFSLCVENKNGSGPFLGNIPKQYCNQILWFDSTDGTFMPSIDVTNESRNDDDDTSVCLGTRQCSWFAGCTNRTWNSSAVPLIGLPNTQDYKWVDRNSGLTWSGNDTCLYSCQNQTKGLLYQLFRNLFCSYGLTEAHGKWRCADASITNDKGHDGHRTPTWWLTGSNLTLSVNNSGLFFLCGNGVYKGFPPKWSGRCGLGYLVPSLTRYLTLNASQITNLRSFIHKVTPHRCTQGDTDNPPLYCNPKDNSTIRALFPSLGTYDLEKAILNISKAMEQEFSATKQTLEAHQSKVSSLASASRKDHVLDIPTTQRQTACGTVGKQCCLYINYSEEIKSNIQRLHEASENLKNVPLLDWQGIFAKVGDWFR

• Full Name: endogenous retrovirus group MER34 member 1, envelope
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: NM_001242690.2
• Gene Symbol: ERVMER34-1
• Gene ID (NCBI): 100288413
• RRID: AB_3745209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H9K5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ERVMER34 (also known as ERVMER34-1) is a human endogenous retrovirus (ERV) envelope protein that has attracted much attention in tumor immunotherapy research in recent years. It is significantly highly expressed in a variety of solid tumors, including colorectal cancer, bladder cancer, lung cancer, breast cancer, and endometrial cancer.