MESDC2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67441-1-Ig (same clone as 67441-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67441-1-Ig (MESDC2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67441-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 67441-1-Ig (same clone as 67441-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67441-1-Ig (MESDC2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67441-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 67441-1-Ig (same clone as 67441-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67441-1-Ig (MESDC2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67441-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 67441-1-Ig (same clone as 67441-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67441-1-Ig (MESDC2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67441-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 67441-1-Ig (same clone as 67441-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using MESDC2 antibody (67441-1-Ig, Clone: 1A2E7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67441-1-PBS in a different storage buffer formulation.

MESDC2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67441-1-PBS

Clone No.1A2E7

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

BOCA, KIAA0081, LDLR chaperone MESD, MESD, MESDC2, Mesoderm development protein

---

Product Information

67441-1-PBS targets MESDC2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1403

  Product name: Recombinant human MESDC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC009210

  Sequence: MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL

• Full Name: mesoderm development candidate 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC009210
• Gene Symbol: MESDC2
• Gene ID (NCBI): 23184
• RRID: AB_2882677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14696
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.