Product Information
60813-1-PBS targets MET as part of a matched antibody pair:
MP51183-1: 60813-1-PBS capture and 60813-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23140 Product name: Recombinant human MET protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 965-1085 aa of BC130420 Sequence: GSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIG Predict reactive species |
| Full Name | met proto-oncogene (hepatocyte growth factor receptor) |
| Calculated Molecular Weight | 1390 aa, 155 kDa |
| GenBank Accession Number | BC130420 |
| Gene Symbol | MET |
| Gene ID (NCBI) | 4233 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P08581 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





