METTL4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• METTL4 Polyclonal antibody (17718-1-AP)

METTL4 Polyclonal Antibody for WB, ELISA

Cat No. 17718-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:2.1.1.-, EC:2.1.1.72, HsT661, methyltransferase like 4, Methyltransferase-like protein 4

• 

  WB analysis of MCF-7 using 17718-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 17718-1-AP (METTL4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 17718-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 17718-1-AP (METTL4 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 17718-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 17718-1-AP (METTL4 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 17718-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 17718-1-AP (METTL4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for METTL4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17718-1-AP targets METTL4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12093

  Product name: Recombinant human METTL4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 125-472 aa of BC111020

  Sequence: ISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIKQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIALESGS

• Full Name: methyltransferase like 4
• Calculated Molecular Weight: 472 aa, 54 kDa
• GenBank Accession Number: BC111020
• Gene Symbol: METTL4
• Gene ID (NCBI): 64863
• RRID: AB_2142047
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N3J2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Methyltransferase like protein 4 (METTL4) is a internal m6Am methyltransferase, which mediates N6-methylation of Am30 on U2 snRNA in the context of an AAG motif in vivo and in vitro. METTL4 belongs to the MT-A70-like family, and like its paralogs METTL3/14, METTL4 is conserved from yeast to human.

Publications

What published studies show

The METTL4 Polyclonal antibody (Cat# 17718-1-AP) has 4 citations published in J Transl Med, EMBO J, Future Oncol, and Am J Cancer Res. The associated research fields include epigenetic signatures in tumor progression, brown adipose tissue formation via RNA methyltransferase stabilization, hepatocellular carcinoma recurrence biomarkers, and m6A RNA modification in cancer chemoresistance. Applications cited include WB and IHC in human and mouse samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Transl Med; A machine learning-based epigenetic signature reveals YTHDC1 stabilizes POU5F1 to oppose tumor progression.; Authors - Chen Fang
mouse	WB	EMBO J; PGE2 -EP3 axis promotes brown adipose tissue formation through stabilization of WTAP RNA methyltransferase.; Authors - Xixi Tao
human	IHC	Future Oncol; METTL4 and METTL5 as biomarkers for recurrence-free survival in hepatocellular carcinoma patients; Authors - Jialing Zhao
human	WB	Am J Cancer Res; Binding of RNA m6A by IGF2BP3 triggers chemoresistance of HCT8 cells via upregulation of ABCB1.; Authors - Zhongmin Yang