METTL6 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84209-4-RR (same clone as 84209-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84209-4-RR (METTL6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84209-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84209-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84209-4-RR against Human METTL6 were performed. The affinity constant is below 1 pM.

METTL6 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84209-4-PBS

Clone No.241482F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

tRNA N(3)-methylcytidine methyltransferase METTL6, Methyltransferase-like protein 6, methyltransferase like 6, hMETTL6, EC:2.1.1.-

---

Product Information

84209-4-PBS targets METTL6 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9714

  Product name: Recombinant human METTL6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-250 aa of BC022400

  Sequence: MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVN

• Full Name: methyltransferase like 6
• Calculated Molecular Weight: 255 aa, 30 kDa
• Observed Molecular Weight: 30-32 kDa
• GenBank Accession Number: BC022400
• Gene Symbol: METTL6
• Gene ID (NCBI): 131965
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8TCB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Methyltransferase-like protein 6 (METTL6) belongs to the METL family. METTL6 is as a crucial regulator of tumor cell growth, and METTL6 is a bona fide transfer RNA (tRNA) methyltransferase, catalyzing the formation of 3-methylcytidine at C32 of specific serine tRNA isoacceptors (PMID:32923617). METTL6 is a member of the RNA methyltransferase family that has been identified in many cancers. The mRNA expression levels of METTL6 were significantly upregulated in HCC tumor tissues compared to that in adjacent non-tumor tissues. CRISPR/Cas9 mediated knockout of METTL6 in hepatocellular carcinoma cell lines remarkably inhibited colony formation, cell proliferation, cell migration, cell invasion and cell attachment ability (PMID:34913069).