MFAP3L Polyclonal antibody

• 

  WB analysis using 33188-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33188-1-AP (MFAP3L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 33188-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33188-1-AP (MFAP3L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

MFAP3L Polyclonal Antibody for WB, ELISA

Cat No. 33188-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

HSD39, HSD-39, KIAA0626, Microfibrillar-associated protein 3-like, Testis development protein NYD-SP9

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33188-1-AP targets MFAP3L in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37478

  Product name: Recombinant human MFAP3L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-149 aa of NM_021647.7

  Sequence: KSVTNSTLNGTNVVLGSVPVIIARTDHIIVKEGNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDM

• Full Name: microfibrillar-associated protein 3-like
• Calculated Molecular Weight: 45 kDa，409aa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_021647.7
• Gene Symbol: MFAP3L
• Gene ID (NCBI): 9848
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75121
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Microfibrillar-associated protein 3-like (MFAP3L) is a member of the microfibril-associated glycoprotein (MAGP) family. MFAP3L exhibits strong expression in the testis. It functions as a dual-specificity kinase, phosphorylating tyrosine and threonine on target proteins. MFAP3L is involved in the nuclear signaling of EGFR and ERK2, playing a role in cell invasion and metastasis in colorectal cancer (PMID: 24735981). It may also participate in the regulation of tumor microenvironment status and molecular subtypes in bladder cancer (PMID: 39489826).