MFF Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MFF Recombinant monoclonal antibody, PBS Only (87972-1-PBS)

MFF Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87972-1-PBS

Clone No.260043G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

AD033, C2orf33, GL004, Mitochondrial fission factor

• 

  WB analysis using 87972-1-RR (same clone as 87972-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87972-1-RR (MFF antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87972-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 87972-1-RR (same clone as 87972-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MFF antibody (87972-1-RR, Clone: 260043G2 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87972-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87972-1-PBS targets MFF in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9990

  Product name: Recombinant human MFF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-238 aa of BC000797

  Sequence: MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR

• Full Name: mitochondrial fission factor
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 27-38 kDa
• GenBank Accession Number: BC000797
• Gene Symbol: MFF
• Gene ID (NCBI): 56947
• RRID: AB_3745841
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9GZY8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mitochondrial Fission Factor (MFF) is a critical regulator of organelle division, specifically playing a central role in the fission of mitochondria and peroxisomes. DRP1, MiD, and MFF form a trimeric complex in which MiD proteins facilitate the MFF-DRP1 interaction. Moreover, MiD51 can inhibit MFF-induced activation of DRP1 GTPase activity. Multiple isoforms of MFF exist due to the alternative splicing. This antibody recognizes the endogenous MFF protein around 26-29 kDa and 35-38 kDa.(PMID: 39365854, PMID: 37291333)