MFSD2 Monoclonal antibody, PBS Only

• 

  WB analysis of human testis using 67965-1-Ig (same clone as 67965-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 67965-1-Ig (MFSD2 antibody) at dilution of 1:5200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67965-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 67965-1-Ig (same clone as 67965-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67965-1-Ig (MFSD2 antibody) at dilution of 1:5200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67965-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 67965-1-Ig (same clone as 67965-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 67965-1-Ig (MFSD2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67965-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 67965-1-Ig (same clone as 67965-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67965-1-Ig (MFSD2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67965-1-PBS in a different storage buffer formulation.

MFSD2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67965-1-PBS

Clone No.2D2B4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

MFSD2a, Major facilitator superfamily domain-containing protein 2A, HsMFSD2A, HMFN0656, FP1147

---

Product Information

67965-1-PBS targets MFSD2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31028

  Product name: Recombinant human MFSD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 453-530 aa of BC092414

  Sequence: AGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELASIL

• Full Name: major facilitator superfamily domain containing 2
• Calculated Molecular Weight: 543 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC092414
• Gene Symbol: MFSD2
• Gene ID (NCBI): 84879
• RRID: AB_2918716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NA29
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MFSD2, also named as MFSD2A, belongs to a large family of presumptive carbohydrate transporters with 10-12 membrane-spanning domains, is located at chromosomal position 1p34.2, and is conserved in evolution. It plays a role in thermogenesis via beta-adrenergic signaling pathway. It may be the main plasma membrane tunicamycin transporter. MFSD2 has three isoforms with MW 50 kDa and 59-60 kDa.