Mouse MGL2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85876-1-RR (same clone as 85876-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85876-1-RR (Mgl2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85876-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 85876-1-RR (same clone as 85876-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85876-1-RR (Mgl2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85876-1-PBS in a different storage buffer formulation.

MGL2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85876-1-PBS

Clone No.242983C6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

Macrophage galactose N-acetyl-galactosamine specific lectin 2 , Macrophage galactose-type C-type lectin 2

---

Product Information

85876-1-PBS targets MGL2 in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2727

  Product name: Recombinant Mouse MGL2 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 72-332 aa of NM_145137.2

  Sequence: SQNSQLRRDLGTLRAILDNTTSKIKAEFQSLDSRADNFEKGISSLKVDVEDHRQELQAGRDLSQKVTSLESTLEKREQALKTDLSDLTDHVQQLETDLKALTCQLANLKNNGSEVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICETELGKASSAHSPQLIASVP

• Full Name: macrophage galactose N-acetyl-galactosamine specific lectin 2
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_145137.2
• Gene Symbol: Mgl2
• Gene ID (NCBI): 216864
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8JZN1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MGL2 is mainly expressed on immature dendritic cell (DCs) , tolerogenic DCs, type 2 DCs, and alternatively activated macrophages. MGL2 protein has carbohydrate-binding activity, specifically recognizing and binding to terminal GalNAc (n-acetyl 2-amino-2-deoxy-D-galactopyranose) residues, including the TN antigen (Galnac- αthrser) . This specific binding makes it play an important role in the recognition and processing of glycosylated pathogens, apoptotic cell fragments and tumor cells.