MGST3 Polyclonal antibody

• 

  WB analysis using 20114-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20114-1-AP (MGST3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

MGST3 Polyclonal Antibody for WB, ELISA

Cat No. 20114-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EC:1.11.1.-, EC:2.5.1.-, EC:4.4.1.20, Glutathione peroxidase MGST3, Glutathione S-transferase 3, mitochondrial

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20114-1-AP targets MGST3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13932

  Product name: Recombinant human MGST3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-152 aa of BC000505

  Sequence: MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH

• Full Name: microsomal glutathione S-transferase 3
• Calculated Molecular Weight: 152 aa, 17 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC000505
• Gene Symbol: MGST3
• Gene ID (NCBI): 4259
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14880
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Microsomal glutathione transferase 3 (MGST3) is member of microsomal prostaglandin E synthases super family that exhibits diversified functions in eicosanoid and GSH metabolism. MGST3 expression level correlates with hippocampal size, and mutation of MGST3 contributes to spinal muscular dystrophy (PMID: 37760932). MGST3 KD did not alter intracellular reactive oxygen species level but selectively reduced the expression of apoptosis indicators which could be associated with the receptor of cysteinyl leukotrienes, the downstream metabolites of MGST3 in arachidonic acid pathway (PMID: 38971310).