MICA Polyclonal antibody

• 

  WB analysis using 12619-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12619-1-AP (MICA antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

MICA Polyclonal Antibody for WB, ELISA

Cat No. 12619-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

MIC A, MIC-A

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, SH-SY5Y cells, U266 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

12619-1-AP targets MICA in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3298

  Product name: Recombinant human MICA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-383 aa of BC016929

  Sequence: SWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGT

• Full Name: MHC class I polypeptide-related sequence A
• Calculated Molecular Weight: 383 aa, 43 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC016929
• Gene Symbol: MICA
• Gene ID (NCBI): 100507436
• RRID: AB_10638612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q29983
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human MHC class I chain-related genes located within the HLA class I region of chromosome 6 encode MHC class I chain-related A and B (MICA and MICB) (PMID: 11429322). MICA and MICB are stress-inducible surface molecules that are not associated with β2-microglobulin and do not present peptides (PMID: 9497295). They are expressed in intestinal epithelium and many epithelial tumors (PMID: 10359807). MICA and MICB are ligands for NKG2D which is an activating receptor that is expressed on most natural killer (NK) cells, CD8 αβ T cells, and γδ T cells (PMID: 10426993; 11491531).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancers (Basel); Inhibition of Checkpoint Kinase 1 (CHK1) Upregulates Interferon Regulatory Factor 1 (IRF1) to Promote Apoptosis and Activate Anti-Tumor Immunity via MICA in Hepatocellular Carcinoma (HCC); Authors - Xicai Li
human	WB	Cancers (Basel); MICA+ Tumor Cell Upregulated Macrophage-Secreted MMP9 via PROS1-AXL Axis to Induce Tumor Immune Escape in Advanced Hepatocellular Carcinoma (HCC); Authors - Qiulin Wu