MICALL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MICALL1 Polyclonal antibody, PBS Only (33503-1-PBS)

• 

  WB analysis using 33503-1-AP (same clone as 33503-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33503-1-AP (MICALL1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33503-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 33503-1-AP (same clone as 33503-1-PBS)

  WB result of MICALL1 antibody (33503-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-MICALL1 transfected A549 cells. This data was developed using the same antibody clone with 33503-1-PBS in a different storage buffer formulation.

MICALL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33503-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

KIAA1668, MICAL Like 1, MICAL-L1, MICAL-Like 1, MICAL-like protein 1

---

Product Information

33503-1-PBS targets MICALL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39169

  Product name: Recombinant human MICALL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 750-863 aa of NM_033386.3

  Sequence: NLEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAKSKSPRDKS

• Full Name: MICAL-like 1
• Calculated Molecular Weight: 93kDa，863aa
• Observed Molecular Weight: 125 kDa
• GenBank Accession Number: NM_033386.3
• Gene Symbol: MICALL1
• Gene ID (NCBI): 85377
• RRID: AB_3742994
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N3F8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MICALL1 (MICAL-like protein 1) is a protein involved in the regulation of cytoskeleton dynamics and is a member of the MICAL family. This protein interacts with other molecules through its N-terminal CH domain and C-terminal coiled-coil domain, primarily regulating the stability of microtubules and actin, thereby affecting processes such as cell shape, migration, and intracellular transport. Studies have shown that MICALL1 plays a key role in neuronal axon guidance, angiogenesis, and the establishment of epithelial cell polarity. Additionally, it binds to Rab GTPases (such as Rab8a) and is involved in vesicle transport and membrane remodeling. Aberrant expression of MICALL1 is associated with tumor metastasis and neurological diseases, with its molecular mechanisms involving precise regulation of cytoskeleton rearrangement, making it a potential therapeutic target.