MICALL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MICALL2 Polyclonal antibody (24408-1-AP)

• Featured Product
• KD/KO Validated

MICALL2 Polyclonal Antibody for WB, ELISA

Cat No. 24408-1-AP Copied!

Publications (9)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

JRAB, MICAL L2, MICAL like 2, MICAL like protein 2, MICALL2

• 

  WB analysis of PC-3 using 24408-1-AP

  WB result of MICALL2 antibody (24408-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MICALL2 transfected PC-3 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 24408-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24408-1-AP (MICALL2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 24408-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 24408-1-AP (MICALL2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MICALL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: DU 145 cells, PC-3 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24408-1-AP targets MICALL2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19931

  Product name: Recombinant human MICALL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 306-605 aa of BC037988

  Sequence: PAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSSAAPCTAAAASHPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKFFQTSAVPPGTSLSGRGPTPSLVLSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAAVPSSQPKTEAPQASPLAKPLQSSSPRVLGLPSRMEPPAPLSTSSTSQASALPPAGRRNLAESSGVGRVGAGSRPKPEAPMAKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPAERTLK

• Full Name: MICAL-like 2
• Calculated Molecular Weight: 904 aa, 98 kDa
• Observed Molecular Weight: 109 kDa
• GenBank Accession Number: BC037988
• Gene Symbol: MICALL2
• Gene ID (NCBI): 79778
• RRID: AB_2879527
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IY33
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MICALL2 antibody (catalog number 24408-1-AP) has 9 total citations. These appear in journals including Cell Communication & Signaling, Journal of Translational Medicine, Biochemical Pharmacology, International Journal of Molecular Sciences, International Dental Journal, Biochimica et Biophysica Acta (Molecular Basis of Disease), Scientific Reports, and Archives of Biochemistry and Biophysics. The associated research fields are predominantly oncology—colorectal, renal, breast, ovarian, and head-and-neck cancers—covering tumor progression, angiogenesis, and drug resistance, plus epithelial-mesenchymal transition and pulmonary fibrosis.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF,IP	Cell Commun Signal; MICALL2 as a substrate of ubiquitinase TRIM21 regulates tumorigenesis of colorectal cancer; Authors - Pushuai Wen ; KD Validated
human	WB,IP,CoIP	J Transl Med; DUSP4-mediated dephosphorylation of PSMD14 enhances PSMD14-dependent deubiquitination of MICALL2 and promotes malignant progression in clear cell renal cell carcinoma.; Authors - Xian-you Zeng
		Biochem Pharmacol; MICALL2 promotes angiogenesis of colorectal cancer by regulating the EGFR/PI3K/AKT/KLF5/VEGFA axis.; Authors - Shuzhen Hu
human	WB,IHC,IF	Biochem Pharmacol; MICAL-L2, as an estrogen-responsive gene, is involved in ER-positive breast cancer cell progression and tamoxifen sensitivity via the AKT/mTOR pathway; Authors - Pushuai Wen ; KD Validated
human	WB,IHC	Int J Mol Sci; Comprehensive Analysis of MICALL2 Reveals Its Potential Roles in EGFR Stabilization and Ovarian Cancer Cell Invasion; Authors - Tianxiang Xia ; KD Validated
		Int Dent J; The Role of SARS1 in Head and Neck Squamous Cell Carcinoma and its Potential as a Diagnostic and Prognostic Biomarker; Authors - Qifeng Zhang

Reviews

1.0 out of 5

1 verified customer reviews

What customers say

The single review for 24408-1-AP reports a Western Blot result at a 1:1,000 dilution using MDCK GII lysate. The reviewer notes that the blot required a long exposure of over 100 seconds and shows multiple background bands. The molecular weight marker used was BioRad Precision Plus. Overall, the review reflects a mixed experience, with the antibody producing a detectable signal but requiring extended exposure and showing some background, suggesting room for optimization in sensitivity and specificity.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Joleen (Verified Customer) (05-04-2019)

WB required long exposure >100s. Multiple background bands. Molecular weight is BioRad Precision Plus.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1k
• Cell Tissue Type: MDCK GII

MICALL2 Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:24408-1-AP)