CoraLite® Plus 488-conjugated MIF Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated MIF Recombinant monoclonal antibody (CL488-83199-2)

• 

  IF Staining of NIH/3T3 using CL488-83199-2

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using CoraLite® Plus 488 MIF antibody (CL488-83199-2, Clone: 230529F2 ) at dilution of 1:200.

MIF Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83199-2

Clone No.230529F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

GIF

---

Tested Applications

• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83199-2 targets MIF in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0574

  Product name: Recombinant mouse MIF protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 2-115 aa of NM_010798.2

  Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

• Full Name: macrophage migration inhibitory factor
• Calculated Molecular Weight: 13KD
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: NM_010798.2
• Gene Symbol: Mif
• Gene ID (NCBI): 17319
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P34884
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Macrophage migration inhibitory factor (MIF) is a homo-trimeric protein that acts as a pleiotropic pro-inflammatory cytokine. It is involved in various functions, including leukocyte recruitment, inflammation, immune responses, cell proliferation, tumorigenesis, and counter-regulation of glucocorticoids (GC). MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.