MINDY3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MINDY3 Polyclonal antibody (26478-1-AP)

• 

  IP experiment of HCT 116 using 26478-1-AP

  IP result of anti-C10orf97 (IP:26478-1-AP, 4ug; Detection:26478-1-AP 1:1000) with HCT 116 cells lysate 1920 ug.

• 

  IHC staining of mouse kidney using 26478-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26478-1-AP (C10orf97 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 26478-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26478-1-AP (C10orf97 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat heart using 26478-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 26478-1-AP (C10orf97 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 26478-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using MINDY3 antibody (26478-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

MINDY3 Polyclonal Antibody for IHC, IF/ICC, IP, ELISA

Cat No. 26478-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, IP, ELISA

Synonyms

C10orf97, CARP, Dermal papilla-derived protein 5, DERP5, Deubiquitinating enzyme MINDY-3

---

Tested Applications

• Positive IP detected in: HCT 116 cells
• Positive IHC detected in: mouse kidney tissue, rat heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26478-1-AP targets MINDY3 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23520

  Product name: Recombinant human C10orf97 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC067799

  Sequence: MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSEKSSWRDCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHS

• Full Name: chromosome 10 open reading frame 97
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC067799
• Gene Symbol: C10orf97
• Gene ID (NCBI): 80013
• RRID: AB_3742191
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H8M7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MINDY3 (also known as FAM63B) is a deubiquitinating enzyme (DUB) localized to the endoplasmic reticulum and belongs to the MINDY family. This protein specifically recognizes and cleaves lysine 48 (K48)-linked ubiquitin chains, which serve as the primary signal targeting proteins for proteasomal degradation, thereby playing a critical role in regulating protein stability. Research indicates that MINDY3 influences various cellular processes through its deubiquitination activity, including endoplasmic reticulum-associated degradation (ERAD), cellular stress response, and cell cycle regulation. Dysregulation of its function is closely associated with pathological processes such as cancer and neurodegenerative diseases, making it a potential target for therapeutic research.